PDB entry 1r05

View 1r05 on RCSB PDB site
Description: solution structure of max b-hlh-lz
Deposited on 2003-09-19, released 2003-10-21
The last revision prior to the SCOP 1.67 freeze date was dated 2003-10-21, with a file datestamp of 2003-10-21.
Experiment type: NMR6
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1r05a_
  • Chain 'B':
    Domains in SCOP 1.67: d1r05b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r05A (A:)
    madkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrkvht
    lqqdiddlkrqnalleqqvralegsgc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r05B (B:)
    madkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrkvht
    lqqdiddlkrqnalleqqvralegsgc