PDB entry 1r00

View 1r00 on RCSB PDB site
Description: Crystal structure of aclacinomycin-10-hydroxylase (RdmB) in complex with S-adenosyl-L-homocysteine (SAH)
Class: oxidoreductase, transferase
Keywords: Anthracycline, hydroxylase, methyltransferase, polyketide, Streptomyces, tailoring enzyme, OXIDOREDUCTASE, TRANSFERASE
Deposited on 2003-09-19, released 2003-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-02-28, with a file datestamp of 2018-02-23.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aclacinomycin-10-hydroxylase
    Species: Streptomyces purpurascens [TaxId:1924]
    Gene: rdmb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1r00a1, d1r00a2
  • Heterogens: ACT, SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r00A (A:)
    msssspgepleptdqdldvllknlgnlvtpmalrvaatlrlvdhllagadtlagladrtd
    thpqalsrlvrhltvvgvleggekqgrplrptrlgmlladghpaqqrawldlngavshad
    laftglldvvrtgrpayagrygrpfwedlsadvaladsfdalmscdedlayeapadaydw
    savrhvldvgggnggmlaaialraphlrgtlvelagpaerarrrfadagladrvtvaegd
    ffkplpvtadvvllsfvllnwsdedaltilrgcvralepggrllvldradvegdgadrff
    stlldlrmltfmggrvrtrdevvdlagsaglalasertsgsttlpfdfsileftavseea
    apaaqasealpaqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r00A (A:)
    leptdqdldvllknlgnlvtpmalrvaatlrlvdhllagadtlagladrtdthpqalsrl
    vrhltvvgvleggekgrplrptrlgmlladghpaqqrawldlngavshadlaftglldvv
    rtgrpayagrygrpfwedlsadvaladsfdalmscdedlayeapadaydwsavrhvldvg
    ggnggmlaaialraphlrgtlvelagpaerarrrfadagladrvtvaegdffkplpvtad
    vvllsfvllnwsdedaltilrgcvralepggrllvldradrffstlldlrmltfmggrvr
    trdevvdlagsaglalasertsgsttlpfdfsileftavs