PDB entry 1qzz

View 1qzz on RCSB PDB site
Description: Crystal structure of aclacinomycin-10-hydroxylase (RdmB) in complex with S-adensyl-L-methionine (SAM)
Class: oxidoreductase, transferase
Keywords: Anthracycline, hydroxylase, methyltransferase, polyketide, Streptomyces, tailoring enzymes, Structural Proteomics in Europe, SPINE, Structural Genomics, OXIDOREDUCTASE, TRANSFERASE
Deposited on 2003-09-19, released 2003-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.21
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aclacinomycin-10-hydroxylase
    Species: Streptomyces purpurascens [TaxId:1924]
    Gene: rdmb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qzza1, d1qzza2
  • Heterogens: ACT, SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qzzA (A:)
    msssspgepleptdqdldvllknlgnlvtpmalrvaatlrlvdhllagadtlagladrtd
    thpqalsrlvrhltvvgvleggekqgrplrptrlgmlladghpaqqrawldlngavshad
    laftglldvvrtgrpayagrygrpfwedlsadvaladsfdalmscdedlayeapadaydw
    savrhvldvgggnggmlaaialraphlrgtlvelagpaerarrrfadagladrvtvaegd
    ffkplpvtadvvllsfvllnwsdedaltilrgcvralepggrllvldradvegdgadrff
    stlldlrmltfmggrvrtrdevvdlagsaglalasertsgsttlpfdfsileftavseea
    apaaqasealpaqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qzzA (A:)
    leptdqdldvllknlgnlvtpmalrvaatlrlvdhllagadtlagladrtdthpqalsrl
    vrhltvvgvleggekgrplrptrlgmlladghpaqqrawldlngavshadlaftglldvv
    rtgrpayagrygrpfwedlsadvaladsfdalmscdedlayeapadaydwsavrhvldvg
    ggnggmlaaialraphlrgtlvelagpaerarrrfadagladrvtvaegdffkplpvtad
    vvllsfvllnwsdedaltilrgcvralepggrllvldradrffstlldlrmltfmggrvr
    trdevvdlagsaglalasertsgsttlpfdfsileftavs