PDB entry 1qzx

View 1qzx on RCSB PDB site
Description: Crystal structure of the complete core of archaeal SRP and implications for inter-domain communication
Class: signaling protein
Keywords: Signal recognition particle, SRP, protein targeting, SRP54, SIGNALING PROTEIN
Deposited on 2003-09-18, released 2003-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 4 Å
R-factor: 0.313
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: signal recognition 54 kda protein
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: SRP54
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qzxa1, d1qzxa2, d1qzxa3
  • Chain 'B':
    Compound: signal recognition 54 kda protein
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: SRP54
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qzxb1, d1qzxb2, d1qzxb3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qzxA (A:)
    mghhhhhhmlenirdavrkfltgstpyekavdefikdlqkslissdvnvklvfsltakik
    erlnkekppsvlerkewfisivydelsklfggdkepnvnptklpfiimlvgvqgsgkttt
    agklayfykkrgykvglvaadvyrpaaydqllqlgnqigvqvygepnnqnpieiakkgvd
    ifvknkmdiiivdtagrhgygeetklleemkemydvlkpddvilvidasigqkaydlasr
    fhqaspigsviitkmdgtakgggalsavvatgatikfigtgekideletfnakrfvsril
    gmgdiesilekvkgleeydkiqkkmedvmegkgkltlrdvyaqiialrkmgplskvlqhi
    pglgimlptpsedqlkigeekirrwlaalnsmtykelenpniidksrmrriaegsgleve
    evrellewynnmnrllkmvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qzxA (A:)
    mlenirdavrkfltgstpyekavdefikdlqkslissdvnvklvfsltakikerlnkekp
    psvlerkewfisivydelsklfggdkepnvnptklpfiimlvgvqgsgktttagklayfy
    kkrgykvglvaadvyrpaaydqllqlgnqigvqvygepnnqnpieiakkgvdifvknkmd
    iiivdtagrhgygeetklleemkemydvlkpddvilvidasigqkaydlasrfhqaspig
    sviitkmdgtakgggalsavvatgatikfigtgekideletfnakrfvsrilgmgdiesi
    lekvkgleeydkiqkkmedltlrdvyaqiialrkmgplskvlqhipglgimlptpsedql
    kigeekirrwlaalnsmtykelenpniidksrmrriaegsgleveevrellewynnmnrl
    lkmvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qzxB (B:)
    mghhhhhhmlenirdavrkfltgstpyekavdefikdlqkslissdvnvklvfsltakik
    erlnkekppsvlerkewfisivydelsklfggdkepnvnptklpfiimlvgvqgsgkttt
    agklayfykkrgykvglvaadvyrpaaydqllqlgnqigvqvygepnnqnpieiakkgvd
    ifvknkmdiiivdtagrhgygeetklleemkemydvlkpddvilvidasigqkaydlasr
    fhqaspigsviitkmdgtakgggalsavvatgatikfigtgekideletfnakrfvsril
    gmgdiesilekvkgleeydkiqkkmedvmegkgkltlrdvyaqiialrkmgplskvlqhi
    pglgimlptpsedqlkigeekirrwlaalnsmtykelenpniidksrmrriaegsgleve
    evrellewynnmnrllkmvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qzxB (B:)
    mlenirdavrkfltgstpyekavdefikdlqkslissdvnvklvfsltakikerlnkekp
    psvlerkewfisivydelsklfggdkepnvnptklpfiimlvgvqgsgktttagklayfy
    kkrgykvglvaadvyrpaaydqllqlgnqigvqvygepnnqnpieiakkgvdifvknkmd
    iiivdtagrhgygeetklleemkemydvlkpddvilvidasigqkaydlasrfhqaspig
    sviitkmdgtakgggalsavvatgatikfigtgekideletfnakrfvsrilgmgdiesi
    lekvkgleeydkiqkkmedltlrdvyaqiialrkmgplskvlqhipglgimlptpsedql
    kigeekirrwlaalnsmtykelenpniidksrmrriaegsgleveevrellewynnmnrl
    lkmvk