PDB entry 1qzx

View 1qzx on RCSB PDB site
Description: Crystal structure of the complete core of archaeal SRP and implications for inter-domain communication
Deposited on 2003-09-18, released 2003-11-18
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-20, with a file datestamp of 2004-01-20.
Experiment type: XRAY
Resolution: 4 Å
R-factor: 0.313
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qzxA (A:)
    mghhhhhhmlenirdavrkfltgstpyekavdefikdlqkslissdvnvklvfsltakik
    erlnkekppsvlerkewfisivydelsklfggdkepnvnptklpfiimlvgvqgsgkttt
    agklayfykkrgykvglvaadvyrpaaydqllqlgnqigvqvygepnnqnpieiakkgvd
    ifvknkmdiiivdtagrhgygeetklleemkemydvlkpddvilvidasigqkaydlasr
    fhqaspigsviitkmdgtakgggalsavvatgatikfigtgekideletfnakrfvsril
    gmgdiesilekvkgleeydkiqkkmedvmegkgkltlrdvyaqiialrkmgplskvlqhi
    pglgimlptpsedqlkigeekirrwlaalnsmtykelenpniidksrmrriaegsgleve
    evrellewynnmnrllkmvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qzxA (A:)
    mlenirdavrkfltgstpyekavdefikdlqkslissdvnvklvfsltakikerlnkekp
    psvlerkewfisivydelsklfggdkepnvnptklpfiimlvgvqgsgktttagklayfy
    kkrgykvglvaadvyrpaaydqllqlgnqigvqvygepnnqnpieiakkgvdifvknkmd
    iiivdtagrhgygeetklleemkemydvlkpddvilvidasigqkaydlasrfhqaspig
    sviitkmdgtakgggalsavvatgatikfigtgekideletfnakrfvsrilgmgdiesi
    lekvkgleeydkiqkkmedltlrdvyaqiialrkmgplskvlqhipglgimlptpsedql
    kigeekirrwlaalnsmtykelenpniidksrmrriaegsgleveevrellewynnmnrl
    lkmvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qzxB (B:)
    mghhhhhhmlenirdavrkfltgstpyekavdefikdlqkslissdvnvklvfsltakik
    erlnkekppsvlerkewfisivydelsklfggdkepnvnptklpfiimlvgvqgsgkttt
    agklayfykkrgykvglvaadvyrpaaydqllqlgnqigvqvygepnnqnpieiakkgvd
    ifvknkmdiiivdtagrhgygeetklleemkemydvlkpddvilvidasigqkaydlasr
    fhqaspigsviitkmdgtakgggalsavvatgatikfigtgekideletfnakrfvsril
    gmgdiesilekvkgleeydkiqkkmedvmegkgkltlrdvyaqiialrkmgplskvlqhi
    pglgimlptpsedqlkigeekirrwlaalnsmtykelenpniidksrmrriaegsgleve
    evrellewynnmnrllkmvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qzxB (B:)
    mlenirdavrkfltgstpyekavdefikdlqkslissdvnvklvfsltakikerlnkekp
    psvlerkewfisivydelsklfggdkepnvnptklpfiimlvgvqgsgktttagklayfy
    kkrgykvglvaadvyrpaaydqllqlgnqigvqvygepnnqnpieiakkgvdifvknkmd
    iiivdtagrhgygeetklleemkemydvlkpddvilvidasigqkaydlasrfhqaspig
    sviitkmdgtakgggalsavvatgatikfigtgekideletfnakrfvsrilgmgdiesi
    lekvkgleeydkiqkkmedltlrdvyaqiialrkmgplskvlqhipglgimlptpsedql
    kigeekirrwlaalnsmtykelenpniidksrmrriaegsgleveevrellewynnmnrl
    lkmvk