PDB entry 1qzt

View 1qzt on RCSB PDB site
Description: phosphotransacetylase from methanosarcina thermophila
Deposited on 2003-09-17, released 2004-06-22
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-22, with a file datestamp of 2004-06-22.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.249
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1qzta_
  • Chain 'B':
    Domains in SCOP 1.69: d1qztb_
  • Chain 'C':
    Domains in SCOP 1.69: d1qztc_
  • Chain 'D':
    Domains in SCOP 1.69: d1qztd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qztA (A:)
    mvtflekiserakklnktialpetedirtlqaaakilergiadivlvgneadikalagdl
    dlskakivdpktyekkdeyinafyelrkhkgitlenaaeimsdyvyfavmmaklgevdgv
    vsgaahsssdtlrpavqivktakgaalasaffiisvpdceygsdgtflfadsgmvempsv
    edvaniavisaktfellvqdvpkvamlsystkgsaksklteatiastklaqelapdiaid
    gelqvdaaivpkvaaskapgspvagkanvfifpdlncgniaykiaqrlakaeaygpitqg
    lakpindlsrgcsdedivgavaitcvqaaaqdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qztA (A:)
    vtflekiserakklnktialpetedirtlqaaakilergiadivlvgneadikalagdld
    lskakivdpktyekkdeyinafyelrkhkgitlenaaeimsdyvyfavmmaklgevdgvv
    sgaahsssdtlrpavqivktakgaalasaffiisvpdceygsdgtflfadsgmvempsve
    dvaniavisaktfellvqdvpkvamlsystkgsaksklteatiastklaqelapdiaidg
    elqvdaaivpkvaaskapgspvagkanvfifpdlncgniaykiaqrlakaeaygpitqgl
    akpindlsrgcsdedivgavaitcvqaaaqdk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qztB (B:)
    mvtflekiserakklnktialpetedirtlqaaakilergiadivlvgneadikalagdl
    dlskakivdpktyekkdeyinafyelrkhkgitlenaaeimsdyvyfavmmaklgevdgv
    vsgaahsssdtlrpavqivktakgaalasaffiisvpdceygsdgtflfadsgmvempsv
    edvaniavisaktfellvqdvpkvamlsystkgsaksklteatiastklaqelapdiaid
    gelqvdaaivpkvaaskapgspvagkanvfifpdlncgniaykiaqrlakaeaygpitqg
    lakpindlsrgcsdedivgavaitcvqaaaqdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qztB (B:)
    vtflekiserakklnktialpetedirtlqaaakilergiadivlvgneadikalagdld
    lskakivdpktyekkdeyinafyelrkhkgitlenaaeimsdyvyfavmmaklgevdgvv
    sgaahsssdtlrpavqivktakgaalasaffiisvpdceygsdgtflfadsgmvempsve
    dvaniavisaktfellvqdvpkvamlsystkgsaksklteatiastklaqelapdiaidg
    elqvdaaivpkvaaskapgspvagkanvfifpdlncgniaykiaqrlakaeaygpitqgl
    akpindlsrgcsdedivgavaitcvqaaaqd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qztC (C:)
    mvtflekiserakklnktialpetedirtlqaaakilergiadivlvgneadikalagdl
    dlskakivdpktyekkdeyinafyelrkhkgitlenaaeimsdyvyfavmmaklgevdgv
    vsgaahsssdtlrpavqivktakgaalasaffiisvpdceygsdgtflfadsgmvempsv
    edvaniavisaktfellvqdvpkvamlsystkgsaksklteatiastklaqelapdiaid
    gelqvdaaivpkvaaskapgspvagkanvfifpdlncgniaykiaqrlakaeaygpitqg
    lakpindlsrgcsdedivgavaitcvqaaaqdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qztC (C:)
    vtflekiserakklnktialpetedirtlqaaakilergiadivlvgneadikalagdld
    lskakivdpktyekkdeyinafyelrkhkgitlenaaeimsdyvyfavmmaklgevdgvv
    sgaahsssdtlrpavqivktakgaalasaffiisvpdceygsdgtflfadsgmvempsve
    dvaniavisaktfellvqdvpkvamlsystkgsaksklteatiastklaqelapdiaidg
    elqvdaaivpkvaaskapgspvagkanvfifpdlncgniaykiaqrlakaeaygpitqgl
    akpindlsrgcsdedivgavaitcvqaaaqd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1qztD (D:)
    mvtflekiserakklnktialpetedirtlqaaakilergiadivlvgneadikalagdl
    dlskakivdpktyekkdeyinafyelrkhkgitlenaaeimsdyvyfavmmaklgevdgv
    vsgaahsssdtlrpavqivktakgaalasaffiisvpdceygsdgtflfadsgmvempsv
    edvaniavisaktfellvqdvpkvamlsystkgsaksklteatiastklaqelapdiaid
    gelqvdaaivpkvaaskapgspvagkanvfifpdlncgniaykiaqrlakaeaygpitqg
    lakpindlsrgcsdedivgavaitcvqaaaqdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qztD (D:)
    vtflekiserakklnktialpetedirtlqaaakilergiadivlvgneadikalagdld
    lskakivdpktyekkdeyinafyelrkhkgitlenaaeimsdyvyfavmmaklgevdgvv
    sgaahsssdtlrpavqivktakgaalasaffiisvpdceygsdgtflfadsgmvempsve
    dvaniavisaktfellvqdvpkvamlsystkgsaksklteatiastklaqelapdiaidg
    elqvdaaivpkvaaskapgspvagkanvfifpdlncgniaykiaqrlakaeaygpitqgl
    akpindlsrgcsdedivgavaitcvqaaaqdk