PDB entry 1qzr

View 1qzr on RCSB PDB site
Description: crystal structure of the ATPase region of saccharomyces cerevisiae topoisomerase II bound to icrf-187 (dexrazoxane)
Class: isomerase
Keywords: ghkl ATPase domain, icrf, icrf-187, dexrazoxane, isomerase
Deposited on 2003-09-17, released 2003-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA topoisomerase II
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: TOP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qzra1, d1qzra2
  • Chain 'B':
    Compound: DNA topoisomerase II
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: TOP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qzrb1, d1qzrb2
  • Heterogens: MG, CDX, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qzrA (A:)
    ghmvtmstepvsasdkyqkisqlehilkrpdtyigsvetqeqlqwiydeetdcmieknvt
    ivpglfkifdeilvnaadnkvrdpsmkridvnihaeehtievkndgkgipieihnkeniy
    ipemifghlltssnydddekkvtggrngygaklcnifstefiletadlnvgqkyvqkwen
    nmsichppkitsykkgpsytkvtfkpdltrfgmkeldndilgvmrrrvydingsvrdinv
    ylngkslkirnfknyvelylkslekkrqldngedgaaksdiptilyerinnrwevafavs
    disfqqisfvnsiattmggthvnyitdqivkkiseilkkkkkksvksfqiknnmfifinc
    lienpaftsqtkeqlttrvkdfgsrceipleyinkimktdlatrmfeiadaneenalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qzrA (A:)
    sasdkyqkisqlehilkrpdtyigsvetqeqlqwiydeetdcmieknvtivpglfkifde
    ilvnaadnkvrdpsmkridvnihaeehtievkndgkgipieihnkeniyipemifghllt
    ssnydddekkvtggrngygaklcnifstefiletadlnvgqkyvqkwennmsichppkit
    sykkgpsytkvtfkpdltrfgmkeldndilgvmrrrvydingsvrdinvylngkslkirn
    fknyvelylksliptilyerinnrwevafavsdisfqqisfvnsiattmggthvnyitdq
    ivkkiseilkkvksfqiknnmfifinclienpaftsqtkeqlttrvkdfgsrceipleyi
    nkimktdlatrmfeiadaneen
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qzrB (B:)
    ghmvtmstepvsasdkyqkisqlehilkrpdtyigsvetqeqlqwiydeetdcmieknvt
    ivpglfkifdeilvnaadnkvrdpsmkridvnihaeehtievkndgkgipieihnkeniy
    ipemifghlltssnydddekkvtggrngygaklcnifstefiletadlnvgqkyvqkwen
    nmsichppkitsykkgpsytkvtfkpdltrfgmkeldndilgvmrrrvydingsvrdinv
    ylngkslkirnfknyvelylkslekkrqldngedgaaksdiptilyerinnrwevafavs
    disfqqisfvnsiattmggthvnyitdqivkkiseilkkkkkksvksfqiknnmfifinc
    lienpaftsqtkeqlttrvkdfgsrceipleyinkimktdlatrmfeiadaneenalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qzrB (B:)
    asdkyqkisqlehilkrpdtyigsvetqeqlqwiydeetdcmieknvtivpglfkifdei
    lvnaadnkvrdpsmkridvnihaeehtievkndgkgipieihnkeniyipemifghllts
    snydddekkvtggrngygaklcnifstefiletadlnvgqkyvqkwennmsichppkits
    ykkgpsytkvtfkpdltrfgmkeldndilgvmrrrvydingsvrdinvylngkslkirnf
    knyvelylkslekiptilyerinnrwevafavsdisfqqisfvnsiattmggthvnyitd
    qivkkiseilkkvksfqiknnmfifinclienpaftsqtkeqlttrvkdfgsrceipley
    inkimktdlatrmfeiad