PDB entry 1qzo

View 1qzo on RCSB PDB site
Description: Three dimensional structure of a goat signalling protein secreted during involution
Deposited on 2003-09-17, released 2004-05-04
The last revision prior to the SCOP 1.67 freeze date was dated 2004-05-04, with a file datestamp of 2004-05-04.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.19
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qzoA (A:)
    yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
    tlknrnpklktllsvggwnfgperfskiasktqsrrtfiksvppflrthgfdgldlawly
    pgrrdkrhltalvkemkaefareaqagterlllsaavsagkiaidrgydiaqisrhldfi
    slltydfhgawrqtvghhsplfrgnsdassrfsnadyavsymlrlgapanklvmgiptfg
    rsftlassktdvgapisgpgipgrftkekgilayyeicdflhgatthrfrdqqvpyatkg
    nqwvayddqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlae
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qzoA (A:)
    yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
    tlknrnpklktllsvggwnfgperfskiasktqsrrtfiksvppflrthgfdgldlawly
    pgrrdkrhltalvkemkaefareaqagterlllsaavsagkiaidrgydiaqisrhldfi
    slltydfhgawrqtvghhsplfrgnsdassrfsnadyavsymlrlgapanklvmgiptfg
    rsftlassktdvgapisgpgipgrftkekgilayyeicdflhgatthrfrdqqvpyatkg
    nqwvayddqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlae