PDB entry 1qzh

View 1qzh on RCSB PDB site
Description: Crystal structure of Pot1 (protection of telomere)- ssDNA complex
Deposited on 2003-09-16, released 2003-11-25
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-25, with a file datestamp of 2003-11-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.249
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1qzha_
  • Chain 'B':
    Domains in SCOP 1.67: d1qzhb_
  • Chain 'C':
    Domains in SCOP 1.67: d1qzhc_
  • Chain 'D':
    Domains in SCOP 1.67: d1qzhd_
  • Chain 'E':
    Domains in SCOP 1.67: d1qzhe_
  • Chain 'F':
    Domains in SCOP 1.67: d1qzhf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qzhA (A:)
    gpggedvidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqs
    lhgtkdwvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdr
    tqglskdqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtnkhkn
    gellsts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qzhA (A:)
    vidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqslhgtkd
    wvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdrtqglsk
    dqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qzhB (B:)
    gpggedvidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqs
    lhgtkdwvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdr
    tqglskdqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtnkhkn
    gellsts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qzhB (B:)
    vidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqslhgtkd
    wvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdrtqglsk
    dqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qzhC (C:)
    gpggedvidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqs
    lhgtkdwvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdr
    tqglskdqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtnkhkn
    gellsts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qzhC (C:)
    vidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqslhgtkd
    wvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdrtqglsk
    dqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1qzhD (D:)
    gpggedvidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqs
    lhgtkdwvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdr
    tqglskdqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtnkhkn
    gellsts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qzhD (D:)
    vidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqslhgtkd
    wvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdrtqglsk
    dqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1qzhE (E:)
    gpggedvidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqs
    lhgtkdwvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdr
    tqglskdqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtnkhkn
    gellsts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qzhE (E:)
    vidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqslhgtkd
    wvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdrtqglsk
    dqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1qzhF (F:)
    gpggedvidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqs
    lhgtkdwvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdr
    tqglskdqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtnkhkn
    gellsts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qzhF (F:)
    vidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqslhgtkd
    wvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdrtqglsk
    dqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtn