PDB entry 1qzh

View 1qzh on RCSB PDB site
Description: Crystal structure of Pot1 (protection of telomere)- ssDNA complex
Class: DNA Binding Protein/DNA
Keywords: protein-DNA complex, single-stranded telomeric DNA, DNA Binding Protein/DNA COMPLEX
Deposited on 2003-09-16, released 2003-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.249
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protection of telomeres protein 1
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: POT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qzha_
  • Chain 'B':
    Compound: Protection of telomeres protein 1
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: POT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qzhb_
  • Chain 'C':
    Compound: Protection of telomeres protein 1
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: POT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qzhc_
  • Chain 'D':
    Compound: Protection of telomeres protein 1
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: POT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qzhd_
  • Chain 'E':
    Compound: Protection of telomeres protein 1
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: POT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qzhe_
  • Chain 'F':
    Compound: Protection of telomeres protein 1
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: POT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qzhf_
  • Chain 'G':
    Compound: telomeric single-stranded DNA
  • Chain 'H':
    Compound: telomeric single-stranded DNA
  • Chain 'I':
    Compound: telomeric single-stranded DNA
  • Chain 'J':
    Compound: telomeric single-stranded DNA
  • Chain 'K':
    Compound: telomeric single-stranded DNA
  • Chain 'L':
    Compound: telomeric single-stranded DNA
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qzhA (A:)
    gpggedvidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqs
    lhgtkdwvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdr
    tqglskdqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtnkhkn
    gellsts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qzhA (A:)
    vidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqslhgtkd
    wvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdrtqglsk
    dqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qzhB (B:)
    gpggedvidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqs
    lhgtkdwvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdr
    tqglskdqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtnkhkn
    gellsts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qzhB (B:)
    vidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqslhgtkd
    wvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdrtqglsk
    dqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qzhC (C:)
    gpggedvidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqs
    lhgtkdwvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdr
    tqglskdqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtnkhkn
    gellsts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qzhC (C:)
    vidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqslhgtkd
    wvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdrtqglsk
    dqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1qzhD (D:)
    gpggedvidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqs
    lhgtkdwvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdr
    tqglskdqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtnkhkn
    gellsts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qzhD (D:)
    vidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqslhgtkd
    wvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdrtqglsk
    dqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1qzhE (E:)
    gpggedvidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqs
    lhgtkdwvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdr
    tqglskdqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtnkhkn
    gellsts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qzhE (E:)
    vidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqslhgtkd
    wvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdrtqglsk
    dqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1qzhF (F:)
    gpggedvidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqs
    lhgtkdwvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdr
    tqglskdqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtnkhkn
    gellsts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qzhF (F:)
    vidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqslhgtkd
    wvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdrtqglsk
    dqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtn
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.