PDB entry 1qzf

View 1qzf on RCSB PDB site
Description: Crystal structure of DHFR-TS from Cryptosporidium hominis
Class: oxidoreductase, transferase
Keywords: bifunctional enzyme, OXIDOREDUCTASE, TRANSFERASE
Deposited on 2003-09-16, released 2003-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.225
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional dihydrofolate reductase-thymidylate synthase
    Species: Cryptosporidium hominis [TaxId:237895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qzfa1, d1qzfa2
  • Chain 'B':
    Compound: Bifunctional dihydrofolate reductase-thymidylate synthase
    Species: Cryptosporidium hominis [TaxId:237895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qzfb1, d1qzfb2
  • Chain 'C':
    Compound: Bifunctional dihydrofolate reductase-thymidylate synthase
    Species: Cryptosporidium hominis [TaxId:237895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qzfc1, d1qzfc2
  • Chain 'D':
    Compound: Bifunctional dihydrofolate reductase-thymidylate synthase
    Species: Cryptosporidium hominis [TaxId:237895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qzfd1, d1qzfd2
  • Chain 'E':
    Compound: Bifunctional dihydrofolate reductase-thymidylate synthase
    Species: Cryptosporidium hominis [TaxId:237895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qzfe1, d1qzfe2
  • Heterogens: UMP, CB3, FOL, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qzfA (A:)
    mseknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwd
    sigrrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyr
    dalkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqek
    ktlqncdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqy
    ldllsrvlengayrenrtgistysifgqmmrfdmresfpllttkkvairsifeeliwfik
    gdtngnhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddy
    tgvgvdqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnl
    yqrscdlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrt
    prpfpqlkfkrkveniedfkwedieligyypyptikmdmav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qzfA (A:)
    eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
    grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
    lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqekkt
    lqncdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqyld
    llsrvlengayrenrtgistysifgqmmrfdmresfpllttkkvairsifeeliwfikgd
    tngnhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytg
    vgvdqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyq
    rscdlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtpr
    pfpqlkfkrkveniedfkwedieligyypyptikmdmav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qzfB (B:)
    mseknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwd
    sigrrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyr
    dalkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqek
    ktlqncdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqy
    ldllsrvlengayrenrtgistysifgqmmrfdmresfpllttkkvairsifeeliwfik
    gdtngnhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddy
    tgvgvdqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnl
    yqrscdlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrt
    prpfpqlkfkrkveniedfkwedieligyypyptikmdmav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qzfB (B:)
    eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
    grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
    lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqekkt
    lqncdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqyld
    llsrvlengayrenrtgistysifgqmmrfdmresfpllttkkvairsifeeliwfikgd
    tngnhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytg
    vgvdqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyq
    rscdlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtpr
    pfpqlkfkrkveniedfkwedieligyypyptikmdmav
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qzfC (C:)
    mseknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwd
    sigrrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyr
    dalkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqek
    ktlqncdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqy
    ldllsrvlengayrenrtgistysifgqmmrfdmresfpllttkkvairsifeeliwfik
    gdtngnhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddy
    tgvgvdqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnl
    yqrscdlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrt
    prpfpqlkfkrkveniedfkwedieligyypyptikmdmav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qzfC (C:)
    eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
    grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
    lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqekkt
    lqncdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqyld
    llsrvlengayrenrtgistysifgqmmrfdmresfpllttkkvairsifeeliwfikgd
    tngnhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytg
    vgvdqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyq
    rscdlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtpr
    pfpqlkfkrkveniedfkwedieligyypyptikmdmav
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1qzfD (D:)
    mseknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwd
    sigrrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyr
    dalkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqek
    ktlqncdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqy
    ldllsrvlengayrenrtgistysifgqmmrfdmresfpllttkkvairsifeeliwfik
    gdtngnhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddy
    tgvgvdqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnl
    yqrscdlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrt
    prpfpqlkfkrkveniedfkwedieligyypyptikmdmav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qzfD (D:)
    eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
    grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
    lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqekkt
    lqncdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqyld
    llsrvlengayrenrtgistysifgqmmrfdmresfpllttkkvairsifeeliwfikgd
    tngnhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytg
    vgvdqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyq
    rscdlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtpr
    pfpqlkfkrkveniedfkwedieligyypyptikmdmav
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1qzfE (E:)
    mseknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwd
    sigrrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyr
    dalkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqek
    ktlqncdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqy
    ldllsrvlengayrenrtgistysifgqmmrfdmresfpllttkkvairsifeeliwfik
    gdtngnhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddy
    tgvgvdqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnl
    yqrscdlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrt
    prpfpqlkfkrkveniedfkwedieligyypyptikmdmav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qzfE (E:)
    eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
    grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
    lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqekkt
    lqncdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqyld
    llsrvlengayrenrtgistysifgqmmrfdmresfpllttkkvairsifeeliwfikgd
    tngnhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytg
    vgvdqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyq
    rscdlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtpr
    pfpqlkfkrkveniedfkwedieligyypyptikmdmav