PDB entry 1qzd

View 1qzd on RCSB PDB site
Description: EF-Tu.kirromycin coordinates fitted into the cryo-EM map of EF-Tu ternary complex (GDP.Kirromycin) bound 70S ribosome
Class: biosynthetic protein
Keywords: Elongation factor, biosynthetic protein
Deposited on 2003-09-16, released 2003-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-06.
Experiment type: EM
Resolution: 10 Å
R-factor: N/A
AEROSPACI score: -0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elongation factor tu
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qzda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qzdA (A:)
    skekfertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargi
    tintshveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehil
    lgrqvgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkaleg
    daeweakilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvge
    eveivgiketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikp
    htkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvv
    tlihpiamddglrfaireggrtvgagvvakvls