PDB entry 1qz9

View 1qz9 on RCSB PDB site
Description: The Three Dimensional Structure of Kynureninase from Pseudomonas fluorescens
Class: hydrolase
Keywords: kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosphate, HYDROLASE
Deposited on 2003-09-16, released 2004-01-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.155
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kynureninase
    Species: Pseudomonas fluorescens [TaxId:294]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qz9a_
  • Heterogens: CL, PLP, P3G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qz9A (A:)
    mttrndclaldaqdslaplrqqfalpegviyldgnslgarpvaalaraqaviaeewgngl
    irswnsagwrdlserlgnrlatligardgevvvtdttsinlfkvlsaalrvqatrsperr
    vivtetsnfptdlyiaegladmlqqgytlrlvdspeelpqaidqdtavvmlthvnyktgy
    mhdmqaltalshecgalaiwdlahsagavpvdlhqagadyaigctykylnggpgsqafvw
    vspqlcdlvpqplsgwfghsrqfamepryepsngiarylcgtqpitslamvecgldvfaq
    tdmaslrrkslaltdlfielveqrcaaheltlvtprehakrgshvsfehpegyaviqali
    drgvigdyreprimrfgftplyttftevwdavqilgeildrktwaqaqfqvrhsvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qz9A (A:)
    ttrndclaldaqdslaplrqqfalpegviyldgnslgarpvaalaraqaviaeewgngli
    rswnsagwrdlserlgnrlatligardgevvvtdttsinlfkvlsaalrvqatrsperrv
    ivtetsnfptdlyiaegladmlqqgytlrlvdspeelpqaidqdtavvmlthvnyktgym
    hdmqaltalshecgalaiwdlahsagavpvdlhqagadyaigctykylnggpgsqafvwv
    spqlcdlvpqplsgwfghsrqfamepryepsngiarylcgtqpitslamvecgldvfaqt
    dmaslrrkslaltdlfielveqrcaaheltlvtprehakrgshvsfehpegyaviqalid
    rgvigdyreprimrfgftplyttftevwdavqilgeildrktwa