PDB entry 1qz7

View 1qz7 on RCSB PDB site
Description: Beta-catenin binding domain of Axin in complex with beta-catenin
Class: cell adhesion
Keywords: Beta-catenin, Axin, protein-protein complex
Deposited on 2003-09-15, released 2003-11-18
The last revision prior to the SCOP 1.73 freeze date was dated 2003-12-02, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.221
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-catenin
    Species: HOMO SAPIENS
    Gene: CTNNB1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1qz7a_
  • Chain 'B':
    Compound: Axin
    Species: Xenopus laevis
    Gene: AXIN
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qz7A (A:)
    khavvnlinyqddaelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrsp
    qmvsaivrtmqntndvetarctagtlhnlshhregllaifksggipalvkmlgspvdsvl
    fyaittlhnlllhqegakmavrlagglqkmvallnktnvkflaittdclqilaygnqesk
    liilasggpqalvnimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltd
    psqrlvqnclwtlrnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnny
    knkmmvcqvggiealvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglp
    vvvkllhppshwplikatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrts
    mggtqqqfvegvrmeeivegctgalhilardvhnrivirglntiplfvqllyspieniqr
    vaagvlcelaqdkeaaeaieaegatapltellhsrnegvatyaaavlfrmsed
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qz7A (A:)
    yqddaelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrt
    mqntndvetarctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhn
    lllhqegakmavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggp
    qalvnimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnc
    lwtlrnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqv
    ggiealvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhpp
    shwplikatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrtsmggtqqqfv
    egvrmeeivegctgalhilardvhnrivirglntiplfvqllyspieniqrvaagvlcel
    aqdkeaaeaieaegatapltellhsrnegvatyaaavlfrmsed
    

  • Chain 'B':
    No sequence available.