PDB entry 1qz2

View 1qz2 on RCSB PDB site
Description: Crystal Structure of FKBP52 C-terminal Domain complex with the C-terminal peptide MEEVD of Hsp90
Class: isomerase/chaperone
Keywords: Isomerase, Rotamase, chaperone, Heat shock, ISOMERASE/CHAPERONE COMPLEX
Deposited on 2003-09-15, released 2004-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.23
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FK506-binding protein 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02790 (21-End)
      • cloning artifact (17-20)
    Domains in SCOPe 2.07: d1qz2a1, d1qz2a2, d1qz2a3
  • Chain 'B':
    Compound: FK506-binding protein 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02790 (21-End)
      • cloning artifact (17-20)
    Domains in SCOPe 2.07: d1qz2b1, d1qz2b2, d1qz2b3
  • Chain 'C':
    Compound: FK506-binding protein 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02790 (21-End)
      • cloning artifact (17-20)
    Domains in SCOPe 2.07: d1qz2c1, d1qz2c2, d1qz2c3
  • Chain 'G':
    Compound: 5-mer peptide from Heat shock protein HSP 90
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: 5-mer peptide from Heat shock protein HSP 90
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qz2A (A:)
    mgsshhhhhhssglvprgshmeedggiirriqtrgegyakpnegaivevalegyykdklf
    dqrelrfeigegenldlpygleraiqrmekgehsivylkpsyafgsvgkekfqippnael
    kyelhlksfekakeswemnseekleqstivkergtvyfkegkykqallqykkivswleye
    ssfsneeaqkaqalrlashlnlamchlklqafsaaiescnkaleldsnnekglfrrgeah
    lavndfelaradfqkvlqlypnnkaaktqlavcqqrirrqlarekklyanmferlaeeen
    kakaeassgdhptdtemkeeqksntagsqsqvetea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qz2A (A:)
    gshmeedggiirriqtrgegyakpnegaivevalegyykdklfdqrelrfeigegenldl
    pygleraiqrmekgehsivylkpsyafgsvgkekfqippnaelkyelhlksfekakeswe
    mnseekleqstivkergtvyfkegkykqallqykkivswleyessfsneeaqkaqalrla
    shlnlamchlklqafsaaiescnkaleldsnnekglfrrgeahlavndfelaradfqkvl
    qlypnnkaaktqlavcqqrirrqlarekklyanmferlaeeenka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qz2B (B:)
    mgsshhhhhhssglvprgshmeedggiirriqtrgegyakpnegaivevalegyykdklf
    dqrelrfeigegenldlpygleraiqrmekgehsivylkpsyafgsvgkekfqippnael
    kyelhlksfekakeswemnseekleqstivkergtvyfkegkykqallqykkivswleye
    ssfsneeaqkaqalrlashlnlamchlklqafsaaiescnkaleldsnnekglfrrgeah
    lavndfelaradfqkvlqlypnnkaaktqlavcqqrirrqlarekklyanmferlaeeen
    kakaeassgdhptdtemkeeqksntagsqsqvetea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qz2B (B:)
    gshmeedggiirriqtrgegyakpnegaivevalegyykdklfdqrelrfeigegenldl
    pygleraiqrmekgehsivylkpsyafgsvgkekfqippnaelkyelhlksfekakeswe
    mnseekleqstivkergtvyfkegkykqallqykkivswleyessfsneeaqkaqalrla
    shlnlamchlklqafsaaiescnkaleldsnnekglfrrgeahlavndfelaradfqkvl
    qlypnnkaaktqlavcqqrirrqlarekklyanmferlaeeenka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qz2C (C:)
    mgsshhhhhhssglvprgshmeedggiirriqtrgegyakpnegaivevalegyykdklf
    dqrelrfeigegenldlpygleraiqrmekgehsivylkpsyafgsvgkekfqippnael
    kyelhlksfekakeswemnseekleqstivkergtvyfkegkykqallqykkivswleye
    ssfsneeaqkaqalrlashlnlamchlklqafsaaiescnkaleldsnnekglfrrgeah
    lavndfelaradfqkvlqlypnnkaaktqlavcqqrirrqlarekklyanmferlaeeen
    kakaeassgdhptdtemkeeqksntagsqsqvetea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qz2C (C:)
    gshmeedggiirriqtrgegyakpnegaivevalegyykdklfdqrelrfeigegenldl
    pygleraiqrmekgehsivylkpsyafgsvgkekfqippnaelkyelhlksfekakeswe
    mnseekleqstivkergtvyfkegkykqallqykkivswleyessfsneeaqkaqalrla
    shlnlamchlklqafsaaiescnkaleldsnnekglfrrgeahlavndfelaradfqkvl
    qlypnnkaaktqlavcqqrirrqlarekklyanmferlaeeenka
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.