PDB entry 1qz1

View 1qz1 on RCSB PDB site
Description: Crystal Structure of the Ig 1-2-3 fragment of NCAM
Class: Cell Adhesion
Keywords: ig modules, cell adhesion, ncam
Deposited on 2003-09-15, released 2003-11-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.218
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neural Cell Adhesion Molecule 1, 140 kDa isoform
    Species: Rattus norvegicus [TaxId:10116]
    Gene: NCAM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13596 (2-290)
      • cloning artifact (1)
    Domains in SCOPe 2.06: d1qz1a1, d1qz1a2, d1qz1a3, d1qz1a4
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qz1A (A:)
    rvlqvdivpsqgeisvgeskfflcqvagdakdkdiswfspngeklspnqqrisvvwnddd
    sstltiynaniddagiykcvvtaedgtqseatvnvkifqklmfknaptpqefkegedavi
    vcdvvsslpptiiwkhkgrdvilkkdvrfivlsnnylqirgikktdegtyrcegrilarg
    einfkdiqvivnvpptvqarqsivnatanlgqsvtlvcdadgfpeptmswtkdgepiene
    eeddekhifsddsseltirnvdkndeaeyvciaenkageqdasihlkvfak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qz1A (A:)
    vlqvdivpsqgeisvgeskfflcqvagdakdkdiswfspngeklspnqqrisvvwnddds
    stltiynaniddagiykcvvtaedgtqseatvnvkifqklmfknaptpqefkegedaviv
    cdvvsslpptiiwkhkgrdvilkkdvrfivlsnnylqirgikktdegtyrcegrilarge
    infkdiqvivnvpptvqarqsivnatanlgqsvtlvcdadgfpeptmswtkdgepiened
    dekhifsddsseltirnvdkndeaeyvciaenkageqdasihlkvfak