PDB entry 1qz0

View 1qz0 on RCSB PDB site
Description: crystal structure of the yersinia pestis phosphatase yoph in complex with a phosphotyrosyl mimetic-containing hexapeptide
Deposited on 2003-09-15, released 2003-11-25
The last revision prior to the SCOP 1.69 freeze date was dated 2004-05-25, with a file datestamp of 2004-05-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.188
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1qz0a_
  • Chain 'B':
    Domains in SCOP 1.69: d1qz0b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qz0A (A:)
    mrerphtsghhgagearatapstvspygpearaelssrlttlrntlapatndprylqacg
    geklnrfrdiqcrrqtavradlnanyiqvgntrtiacqyplqsqleshfrmlaenrtpvl
    avlassseianqrfgmpdyfrqsgtygsitveskmtqqvglgdgimadmytltireagqk
    tisvpvvhvgnwpdqtavssevtkalaslvdqtaetkrnmyeskgssavaddsklrpvih
    cragvgrtaqligamcmndsrnsqlsvedmvsqmrvqrngimvqkdeqldvliklaegqg
    rpllns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qz0A (A:)
    spygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlna
    nyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsg
    tygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevtk
    alaslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrnsq
    lsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qz0B (B:)
    mrerphtsghhgagearatapstvspygpearaelssrlttlrntlapatndprylqacg
    geklnrfrdiqcrrqtavradlnanyiqvgntrtiacqyplqsqleshfrmlaenrtpvl
    avlassseianqrfgmpdyfrqsgtygsitveskmtqqvglgdgimadmytltireagqk
    tisvpvvhvgnwpdqtavssevtkalaslvdqtaetkrnmyeskgssavaddsklrpvih
    cragvgrtaqligamcmndsrnsqlsvedmvsqmrvqrngimvqkdeqldvliklaegqg
    rpllns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qz0B (B:)
    spygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlna
    nyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsg
    tygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevtk
    alaslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrnsq
    lsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns