PDB entry 1qyx

View 1qyx on RCSB PDB site
Description: Crystal structure of human estrogenic 17beta-hydroxysteroid dehydrogenase complex with androstenedione and NADP
Class: oxidoreductase
Keywords: 17bHSD1, androstenedione, C19-steroid, NADP binding, OXIDOREDUCTASE
Deposited on 2003-09-12, released 2004-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estradiol 17 beta-dehydrogenase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qyxa_
  • Heterogens: ASD, NAP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qyxA (A:)
    artvvlitgcssgiglhlavrlasdpsqsfkvyatlrdlktqgrlweaaralacppgsle
    tlqldvrdsksvaaarervtegrvdvlvcnaglgllgplealgedavasvldvnvvgtvr
    mlqaflpdmkrrgsgrvlvtgsvgglmglpfndvycaskfaleglceslavlllpfgvhl
    sliecgpvhtafmekvlgspeevldrtdihtfhrfyqylahskqvfreaaqnpeevaevf
    ltalrapkptlryftterflpllrmrlddpsgsnyvtamhrevfgdvpakaeagaeaggg
    agpgaedeagrsavgdpelgdppaapq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qyxA (A:)
    artvvlitgcssgiglhlavrlasdpsqsfkvyatlrdlktqgrlweaaralacppgsle
    tlqldvrdsksvaaarervtegrvdvlvcnaglgllgplealgedavasvldvnvvgtvr
    mlqaflpdmkrrgsgrvlvtgsvgglmglpfndvycaskfaleglceslavlllpfgvhl
    sliecgpvhtspeevldrtdihtfhrfyqylahskqvfreaaqnpeevaevfltalrapk
    ptlryftterflpllrmrlddpsgsnyvtamhrevfg