PDB entry 1qyu

View 1qyu on RCSB PDB site
Description: Structure of the catalytic domain of 23S rRNA pseudouridine synthase RluD
Class: lyase
Keywords: catalytic domain, rlud, pseudouridine synthase, lyase
Deposited on 2003-09-12, released 2003-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.219
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosomal large subunit pseudouridine synthase D
    Species: Escherichia coli [TaxId:562]
    Gene: RLUD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33643 (Start-348)
      • modified residue (168)
      • modified residue (201)
      • modified residue (221)
      • modified residue (237)
      • modified residue (262)
      • modified residue (305)
      • modified residue (317)
      • modified residue (327)
      • modified residue (334)
    Domains in SCOPe 2.07: d1qyua_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qyuA (A:)
    mgsshhhhhhssglvprgshmasmaqrvqltatvsenqlgqrldqalaemfpdysrsrik
    ewildqrvlvngkvcdkpkekvlggeqvainaeieeearfepqdipldivyedediiiin
    kprdlvvhpgagnpdgtvlnallhyyppiadvpragivhrldkdttglmvvaktvpaqtr
    lveslqrreitreyeavaighmtaggtvdepisrhptkrthmavhpmgkpavthyrimeh
    frvhtrlrlrletgrthqirvhmahithplvgdpvyggrprppkgaseafistlrkfdrq
    alhatmlrlyhpisgiemewhapipqdmvelievmradfeehkdevdwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qyuA (A:)
    fepqdipldivyedediiiinkprdlvvhpgagnpdgtvlnallhyyppiadvpragivh
    rldkdttglmvvaktvpaqtrlveslqrreitreyeavaighmtaggtvdepisrhptkr
    thmavhpmgkpavthyrimehfrvhtrlrlrletgrthqirvhmahithplvgdpvyggr
    prppkgaseafistlrkfdrqalhatmlrlyhpisgiemewhapipqdmvelievmradf
    eehkdevdwl