PDB entry 1qys

View 1qys on RCSB PDB site
Description: Crystal structure of Top7: A computationally designed protein with a novel fold
Class: de novo protein
Keywords: alpha-beta, computationally designed, novel fold, DE NOVO PROTEIN
Deposited on 2003-09-11, released 2003-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.268
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: top7
    Species: Computationally Designed Sequence
    Database cross-references and differences (RAF-indexed):
    • PDB 1QYS
    Domains in SCOPe 2.08: d1qysa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qysA (A:)
    mgdiqvqvniddngknfdytytvtteselqkvlnelmdyikkqgakrvrisitartkkea
    ekfaailikvfaelgyndinvtfdgdtvtvegqleggslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qysA (A:)
    diqvqvniddngknfdytytvtteselqkvlnelmdyikkqgakrvrisitartkkeaek
    faailikvfaelgyndinvtfdgdtvtvegql