PDB entry 1qyr

View 1qyr on RCSB PDB site
Description: 2.1 Angstrom Crystal structure of KsgA: A Universally Conserved Adenosine Dimethyltransferase
Class: transferase, translation
Keywords: Kasugamycin resistance; adenosine dimethyltransferase; rRNA modification, TRANSFERASE, TRANSLATION
Deposited on 2003-09-11, released 2004-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.194
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: High level Kasugamycin resistance protein
    Species: Escherichia coli [TaxId:562]
    Gene: ksgA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qyra_
  • Chain 'B':
    Compound: High level Kasugamycin resistance protein
    Species: Escherichia coli [TaxId:562]
    Gene: ksgA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qyrb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qyrA (A:)
    qnflndqfvidsivsainpqkgqamveigpglaaltepvgerldqltvieldrdlaarlq
    thpflgpkltiyqqdamtfnfgelaekmgqplrvfgnlpynistplmfhlfsytdaiadm
    hfmlqkevvnrlvagpnskaygrlsvmaqyycnvipvlevppsaftpppkvdsavvrlvp
    hatmphpvkdvrvlsritteafnqrrktirnslgnlfsvevltgmgidpamraenisvaq
    ycqmanylaena
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qyrB (B:)
    qnflndqfvidsivsainpqkgqamveigpglaaltepvgerldqltvieldrdlaarlq
    thpflgpkltiyqqdamtfnfgelaekmgqplrvfgnlpynistplmfhlfsytdaiadm
    hfmlqkevvnrlvagpnskaygrlsvmaqyycnvipvlevppsaftpppkvdsavvrlvp
    hatmphpvkdvrvlsritteafnqrrktirnslgnlfsvevltgmgidpamraenisvaq
    ycqmanylaena