PDB entry 1qyp

View 1qyp on RCSB PDB site
Description: thermococcus celer rpb9, nmr, 25 structures
Class: transcription
Keywords: transcription, RNA polymerase II subunit, rpb9, zn ribbon, hyperthermophilic, extremophile
Deposited on 1997-08-19, released 1997-12-24
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase II
    Species: THERMOCOCCUS CELER [TaxId:2264]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1qypa_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qypA (A:)
    gshmeqdlktlpttkitcpkcgndtaywwemqtragdepstifykctkcghtwrsye