PDB entry 1qyp

View 1qyp on RCSB PDB site
Description: thermococcus celer rpb9, nmr, 25 structures
Deposited on 1997-08-19, released 1997-12-24
The last revision prior to the SCOP 1.57 freeze date was dated 1997-12-24, with a file datestamp of 1997-12-24.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1qyp__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qyp_ (-)
    gshmeqdlktlpttkitcpkcgndtaywwemqtragdepstifykctkcghtwrsye