PDB entry 1qyo

View 1qyo on RCSB PDB site
Description: Anaerobic precylization intermediate crystal structure for S65G Y66G GFP variant
Class: luminescent protein
Keywords: beta barrel, chromophore, trapped intermediate, LUMINESCENT PROTEIN
Deposited on 2003-09-11, released 2003-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.197
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: green-fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212
      • engineered (63-65)
      • engineered (98)
      • engineered (152)
      • engineered (162)
    Domains in SCOPe 2.07: d1qyoa1, d1qyoa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qyoA (A:)
    mskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
    vttlgggvqcfsrypdhmkqhdffksampegyvqertisfkddgnyktraevkfegdtlv
    nrielkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqlad
    hyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qyoA (A:)
    skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
    ttlgggvqcfsrypdhmkqhdffksampegyvqertisfkddgnyktraevkfegdtlvn
    rielkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqladh
    yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdely