PDB entry 1qyi

View 1qyi on RCSB PDB site
Description: x-ray structure of q8nw41 northeast structural genomics consortium target zr25.
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2003-09-10, released 2003-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.216
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Staphylococcus aureus subsp. aureus [TaxId:196620]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NW41 (0-375)
      • modified residue (0)
      • modified residue (30)
      • modified residue (79)
      • modified residue (104)
      • modified residue (274)
      • cloning artifact (376-377)
      • expression tag (378-379)
    Domains in SCOPe 2.07: d1qyia1, d1qyia2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qyiA (A:)
    mkkilfdvdgvflseercfdvsaltvyellmdkcylglhshidwetltdndiqdirnrif
    qkdkilnklkslglnsnwdmlfivfsihlidilkklshdeieafmyqdepvelklqnist
    nladcfnlneqlplqfldnvkvgknniyaaleefattelhvsdatlfslkgalwtlaqev
    yqewylgsklyedvekkiarttfktgyiyqeiilrpvdevkvllndlkgagfelgiatgr
    pytetvvpfenlgllpyfeadfiatasdvleaenmypqarplgkpnpfsyiaalygnnrd
    kyesyinkqdnivnkddvfivgdsladllsaqkigatfigtltglkgkdaageleahhad
    yvinhlgelrgvldnllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qyiA (A:)
    mkkilfdvdgvflseercfdvsaltvyellmdkcylglhshidwetltdndiqdirnrif
    qkdkilnklkslglnsnwdmlfivfsihlidilkklshdeieafmyqdepvelklqnist
    nladcfnlneqlplqfldnvkvgknniyaaleefattelhvsdatlfslkgalwtlaqev
    yqewylgsklyedvekkiarttfktgyiyqeiilrpvdevkvllndlkgagfelgiatgr
    pytetvvpfenlgllpyfeadfiatasdvleaenmypqarplgkpnpfsyiaalygnnrd
    kyesyinkqdnivnkddvfivgdsladllsaqkigatfigtltglkgkdaageleahhad
    yvinhlgelrgvldnllehh