PDB entry 1qyg

View 1qyg on RCSB PDB site
Description: anti-cocaine antibody m82g2 complexed with benzoylecgonine
Deposited on 2003-09-10, released 2003-09-23
The last revision prior to the SCOP 1.67 freeze date was dated 2003-09-23, with a file datestamp of 2003-09-23.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.178
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1qygH (H:)
    evtlqesggglvqpggsmklscaasgftfsdawvdwvrqspgkglewvaeirnkannhat
    kytesvkgrftisrddskssvylqmnslraedtgiyyctsvpqlgrgfaywgqgtlvtvs
    aasttppsvyplapgsggastsgsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavl
    qsdlytlsssvtvpsstwpsqtvtcnvahpasstqvdkkivpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qygH (H:)
    evtlqesggglvqpggsmklscaasgftfsdawvdwvrqspgkglewvaeirnkannhat
    kytesvkgrftisrddskssvylqmnslraedtgiyyctsvpqlgrgfaywgqgtlvtvs
    aasttppsvyplapgsggagsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlqsd
    lytlsssvtvpsstwpsqtvtcnvahpasstqvdkkivpk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qygL (L:)
    divmtqaapsvpvtpgesvsiscrssksllhsngytylhwflqrpgqspqlliyrvsnla
    sgvpdrfsgsgsgtaftlrfsrveaedvgvyycmqhleypftfgsgtkleikradaaptv
    sifppsseqltsggasvvcflnnfypqditvswkidgaerssgvlnswtdqdssdstysm
    sstltltkdeyerhssytceathktstspitksfnrge