PDB entry 1qyd

View 1qyd on RCSB PDB site
Description: Crystal structures of pinoresinol-lariciresinol and phenylcoumaran benzylic ether reductases, and their relationship to isoflavone reductases
Class: plant protein
Keywords: NADPH-dependent aromatic alcohol reductases, PCBER, PLR, IFR, lignans, isoflavonoids, plant protein
Deposited on 2003-09-10, released 2003-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.193
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pinoresinol-lariciresinol reductase
    Species: Thuja plicata [TaxId:3316]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qyda_
  • Chain 'B':
    Compound: pinoresinol-lariciresinol reductase
    Species: Thuja plicata [TaxId:3316]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qydb_
  • Chain 'C':
    Compound: pinoresinol-lariciresinol reductase
    Species: Thuja plicata [TaxId:3316]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qydc_
  • Chain 'D':
    Compound: pinoresinol-lariciresinol reductase
    Species: Thuja plicata [TaxId:3316]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qydd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qydA (A:)
    mdkksrvlivggtgyigkrivnasislghptyvlfrpevvsnidkvqmllyfkqlgakli
    easlddhqrlvdalkqvdvvisalaggvlshhileqlklveaikeagnikrflpsefgmd
    pdimehalqpgsitfidkrkvrraieaasipytyvssnmfagyfagslaqldghmmpprd
    kvliygdgnvkgiwvdeddvgtytiksiddpqtlnktmyirppmnilsqkeviqiwerls
    eqnldkiyissqdfladmkdksyeekivrchlyqiffrgdlynfeigpnaieatklypev
    kyvtmdsyleryv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qydA (A:)
    dkksrvlivggtgyigkrivnasislghptyvlfrpevvsnidkvqmllyfkqlgaklie
    aslddhqrlvdalkqvdvvisalaggvlshhileqlklveaikeagnikrflpsefgmdp
    dimehalqpgsitfidkrkvrraieaasipytyvssnmfagyfagslaqldghmmpprdk
    vliygdgnvkgiwvdeddvgtytiksiddpqtlnktmyirppmnilsqkeviqiwerlse
    qnldkiyissqdfladmkdksyeekivrchlyqiffrgdlynfeigpnaieatklypevk
    yvtmdsyleryv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qydB (B:)
    mdkksrvlivggtgyigkrivnasislghptyvlfrpevvsnidkvqmllyfkqlgakli
    easlddhqrlvdalkqvdvvisalaggvlshhileqlklveaikeagnikrflpsefgmd
    pdimehalqpgsitfidkrkvrraieaasipytyvssnmfagyfagslaqldghmmpprd
    kvliygdgnvkgiwvdeddvgtytiksiddpqtlnktmyirppmnilsqkeviqiwerls
    eqnldkiyissqdfladmkdksyeekivrchlyqiffrgdlynfeigpnaieatklypev
    kyvtmdsyleryv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qydB (B:)
    dkksrvlivggtgyigkrivnasislghptyvlfrpevvsnidkvqmllyfkqlgaklie
    aslddhqrlvdalkqvdvvisalaggvlshhileqlklveaikeagnikrflpsefgmdp
    dimehalqpgsitfidkrkvrraieaasipytyvssnmfagyfagslaqldghmmpprdk
    vliygdgnvkgiwvdeddvgtytiksiddpqtlnktmyirppmnilsqkeviqiwerlse
    qnldkiyissqdfladmkdksyeekivrchlyqiffrgdlynfeigpnaieatklypevk
    yvtmdsyleryv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qydC (C:)
    mdkksrvlivggtgyigkrivnasislghptyvlfrpevvsnidkvqmllyfkqlgakli
    easlddhqrlvdalkqvdvvisalaggvlshhileqlklveaikeagnikrflpsefgmd
    pdimehalqpgsitfidkrkvrraieaasipytyvssnmfagyfagslaqldghmmpprd
    kvliygdgnvkgiwvdeddvgtytiksiddpqtlnktmyirppmnilsqkeviqiwerls
    eqnldkiyissqdfladmkdksyeekivrchlyqiffrgdlynfeigpnaieatklypev
    kyvtmdsyleryv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qydC (C:)
    dkksrvlivggtgyigkrivnasislghptyvlfrpevvsnidkvqmllyfkqlgaklie
    aslddhqrlvdalkqvdvvisalaggvlshhileqlklveaikeagnikrflpsefgmdp
    dimehalqpgsitfidkrkvrraieaasipytyvssnmfagyfagslaqldghmmpprdk
    vliygdgnvkgiwvdeddvgtytiksiddpqtlnktmyirppmnilsqkeviqiwerlse
    qnldkiyissqdfladmkdksyeekivrchlyqiffrgdlynfeigpnaieatklypevk
    yvtmdsyleryv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1qydD (D:)
    mdkksrvlivggtgyigkrivnasislghptyvlfrpevvsnidkvqmllyfkqlgakli
    easlddhqrlvdalkqvdvvisalaggvlshhileqlklveaikeagnikrflpsefgmd
    pdimehalqpgsitfidkrkvrraieaasipytyvssnmfagyfagslaqldghmmpprd
    kvliygdgnvkgiwvdeddvgtytiksiddpqtlnktmyirppmnilsqkeviqiwerls
    eqnldkiyissqdfladmkdksyeekivrchlyqiffrgdlynfeigpnaieatklypev
    kyvtmdsyleryv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qydD (D:)
    dkksrvlivggtgyigkrivnasislghptyvlfrpevvsnidkvqmllyfkqlgaklie
    aslddhqrlvdalkqvdvvisalaggvlshhileqlklveaikeagnikrflpsefgmdp
    dimehalqpgsitfidkrkvrraieaasipytyvssnmfagyfagslaqldghmmpprdk
    vliygdgnvkgiwvdeddvgtytiksiddpqtlnktmyirppmnilsqkeviqiwerlse
    qnldkiyissqdfladmkdksyeekivrchlyqiffrgdlynfeigpnaieatklypevk
    yvtmdsyleryv