PDB entry 1qyc

View 1qyc on RCSB PDB site
Description: Crystal structures of pinoresinol-lariciresinol and phenylcoumaran benzylic ether reductases, and their relationship to isoflavone reductases
Class: plant protein
Keywords: NADPH-dependent aromatic alcohol reductases, PCBER, PLR, IFR, lignans, isoflavonoids, PLANT PROTEIN
Deposited on 2003-09-10, released 2003-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.195
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phenylcoumaran benzylic ether reductase PT1
    Species: Pinus taeda [TaxId:3352]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qyca_
  • Chain 'B':
    Compound: phenylcoumaran benzylic ether reductase PT1
    Species: Pinus taeda [TaxId:3352]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qycb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qycA (A:)
    mgsrsrilligatgyigrhvakasldlghptfllvrestassnsekaqllesfkasgani
    vhgsiddhaslveavknvdvvistvgslqiesqvniikaikevgtvkrffpsefgndvdn
    vhavepaksvfevkakvrraieaegipytyvssncfagyflrslaqagltapprdkvvil
    gdgnarvvfvkeedigtftikavddprtlnktlylrlpantlslnelvalwekkidktle
    kayvpeeevlkliadtpfpanisiaishsifvkgdqtnfeigpagveasqlypdvkyttv
    deylsnfv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qycA (A:)
    gsrsrilligatgyigrhvakasldlghptfllvrestassnsekaqllesfkasganiv
    hgsiddhaslveavknvdvvistvgslqiesqvniikaikevgtvkrffpsefgndvdnv
    havepaksvfevkakvrraieaegipytyvssncfagyflrslaqagltapprdkvvilg
    dgnarvvfvkeedigtftikavddprtlnktlylrlpantlslnelvalwekkidktlek
    ayvpeeevlkliadtpfpanisiaishsifvkgdqtnfeigpagveasqlypdvkyttvd
    eylsnfv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qycB (B:)
    mgsrsrilligatgyigrhvakasldlghptfllvrestassnsekaqllesfkasgani
    vhgsiddhaslveavknvdvvistvgslqiesqvniikaikevgtvkrffpsefgndvdn
    vhavepaksvfevkakvrraieaegipytyvssncfagyflrslaqagltapprdkvvil
    gdgnarvvfvkeedigtftikavddprtlnktlylrlpantlslnelvalwekkidktle
    kayvpeeevlkliadtpfpanisiaishsifvkgdqtnfeigpagveasqlypdvkyttv
    deylsnfv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qycB (B:)
    gsrsrilligatgyigrhvakasldlghptfllvrestassnsekaqllesfkasganiv
    hgsiddhaslveavknvdvvistvgslqiesqvniikaikevgtvkrffpsefgndvdnv
    havepaksvfevkakvrraieaegipytyvssncfagyflrslaqagltapprdkvvilg
    dgnarvvfvkeedigtftikavddprtlnktlylrlpantlslnelvalwekkidktlek
    ayvpeeevlkliadtpfpanisiaishsifvkgdqtnfeigpagveasqlypdvkyttvd
    eylsnfv