PDB entry 1qya

View 1qya on RCSB PDB site
Description: crystal structure of e. coli protein ydde
Class: unknown function
Keywords: putative phenazine biosynthesis protein; epimerase; antibiotic biosynthesis protein; structural genomics, unknown function
Deposited on 2003-09-10, released 2004-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.188
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yddE
    Species: Escherichia coli [TaxId:562]
    Gene: YDDE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37757 (10-306)
      • cloning artifact (10)
    Domains in SCOPe 2.08: d1qyaa1, d1qyaa2, d1qyaa3
  • Chain 'B':
    Compound: Hypothetical protein yddE
    Species: Escherichia coli [TaxId:562]
    Gene: YDDE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37757 (10-306)
      • cloning artifact (0-10)
    Domains in SCOPe 2.08: d1qyab1, d1qyab2, d1qyab3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qyaA (A:)
    estslykkaglkpqvyhvdaftsqpfrgnsagvvfpadnlseaqmqliarelghsetafl
    lhsddsdvriryftptvevpicghatvaahyvrakvlglgnctiwqtslagkhrvtiekh
    nddyrisleqgtpgfepplegetraaiinalhlteddilpglpiqvattghskvmiplkp
    evdidalspdlnaltaiskkigcngffpfqirpgknetdgrmfspaigivedpvtgnang
    pmgawlvhhnvlphdgnvlrvkghqgralgrdgmievtvtirdnqpekvtisgtavilfh
    aewaiel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qyaA (A:)
    lkpqvyhvdaftsqpfrgnsagvvfpadnlseaqmqliarelghsetafllhsddsdvri
    ryftptvevpihatvaahyvrakvlglgnctiwqtslkhrvtiekhnddyrisleqgtpg
    fepplegetraaiinalhlteddilpglpiqvattghskvmiplkpevdidalspdlnal
    taiskkigcngffpfqirpgknetdgrmfspaigivedpvtgnangpmgawlvhhnvlph
    dgnvlrvkghqgralgrdgmievtvtirdnqpekvtisgtavilfhaewaiel
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qyaB (B:)
    estslykkaglkpqvyhvdaftsqpfrgnsagvvfpadnlseaqmqliarelghsetafl
    lhsddsdvriryftptvevpicghatvaahyvrakvlglgnctiwqtslagkhrvtiekh
    nddyrisleqgtpgfepplegetraaiinalhlteddilpglpiqvattghskvmiplkp
    evdidalspdlnaltaiskkigcngffpfqirpgknetdgrmfspaigivedpvtgnang
    pmgawlvhhnvlphdgnvlrvkghqgralgrdgmievtvtirdnqpekvtisgtavilfh
    aewaiel