PDB entry 1qy9

View 1qy9 on RCSB PDB site
Description: Crystal structure of E. coli Se-MET protein YDDE
Class: unknown function
Keywords: putative phenazine biosynthesis protein; epimerase; antibiotic biosynthesis protein; structural genomics, unknown function
Deposited on 2003-09-10, released 2004-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.172
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yddE
    Species: Escherichia coli [TaxId:562]
    Gene: YDDE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37757 (Start-296)
      • modified residue (34)
      • modified residue (164)
      • modified residue (211)
      • modified residue (231)
      • modified residue (263)
    Domains in SCOPe 2.08: d1qy9a1, d1qy9a2
  • Chain 'B':
    Compound: Hypothetical protein yddE
    Species: Escherichia coli [TaxId:562]
    Gene: YDDE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37757 (Start-296)
      • modified residue (34)
      • modified residue (164)
      • modified residue (211)
      • modified residue (231)
      • modified residue (263)
    Domains in SCOPe 2.08: d1qy9b1, d1qy9b2
  • Chain 'C':
    Compound: Hypothetical protein yddE
    Species: Escherichia coli [TaxId:562]
    Gene: YDDE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37757 (Start-296)
      • modified residue (34)
      • modified residue (164)
      • modified residue (211)
      • modified residue (231)
      • modified residue (263)
    Domains in SCOPe 2.08: d1qy9c1, d1qy9c2
  • Chain 'D':
    Compound: Hypothetical protein yddE
    Species: Escherichia coli [TaxId:562]
    Gene: YDDE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37757 (0-296)
      • modified residue (0)
      • modified residue (34)
      • modified residue (164)
      • modified residue (211)
      • modified residue (231)
      • modified residue (263)
    Domains in SCOPe 2.08: d1qy9d1, d1qy9d2
  • Heterogens: OH, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qy9A (A:)
    mkpqvyhvdaftsqpfrgnsagvvfpadnlseaqmqliarelghsetafllhsddsdvri
    ryftptvevpicghatvaahyvrakvlglgnctiwqtslagkhrvtiekhnddyrisleq
    gtpgfepplegetraaiinalhlteddilpglpiqvattghskvmiplkpevdidalspd
    lnaltaiskkigcngffpfqirpgknetdgrmfspaigivedpvtgnangpmgawlvhhn
    vlphdgnvlrvkghqgralgrdgmievtvtirdnqpekvtisgtavilfhaewaiel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qy9A (A:)
    pqvyhvdaftsqpfrgnsagvvfpadnlseaqmqliarelghsetafllhsddsdvriry
    ftptvevpicghatvaahyvrakvlglgnctiwqtslagkhrvtiekhnddyrisleqgt
    pgfepplegetraaiinalhlteddilpglpiqvattghskvmiplkpevdidalspdln
    altaiskkigcngffpfqirpgknetdgrmfspaigivedpvtgnangpmgawlvhhnvl
    phdgnvlrvkghqgralgrdgmievtvtirdnqpekvtisgtavilfhaewaiel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qy9B (B:)
    mkpqvyhvdaftsqpfrgnsagvvfpadnlseaqmqliarelghsetafllhsddsdvri
    ryftptvevpicghatvaahyvrakvlglgnctiwqtslagkhrvtiekhnddyrisleq
    gtpgfepplegetraaiinalhlteddilpglpiqvattghskvmiplkpevdidalspd
    lnaltaiskkigcngffpfqirpgknetdgrmfspaigivedpvtgnangpmgawlvhhn
    vlphdgnvlrvkghqgralgrdgmievtvtirdnqpekvtisgtavilfhaewaiel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qy9B (B:)
    pqvyhvdaftsqpfrgnsagvvfpadnlseaqmqliarelghsetafllhsddsdvriry
    ftptvevpicghatvaahyvrakvlglgnctiwqtslagkhrvtiekhnddyrisleqgt
    pgfepplegetraaiinalhlteddilpglpiqvattghskvmiplkpevdidalspdln
    altaiskkigcngffpfqirpgknetdgrmfspaigivedpvtgnangpmgawlvhhnvl
    phdgnvlrvkghqgralgrdgmievtvtirdnqpekvtisgtavilfhaewaiel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qy9C (C:)
    mkpqvyhvdaftsqpfrgnsagvvfpadnlseaqmqliarelghsetafllhsddsdvri
    ryftptvevpicghatvaahyvrakvlglgnctiwqtslagkhrvtiekhnddyrisleq
    gtpgfepplegetraaiinalhlteddilpglpiqvattghskvmiplkpevdidalspd
    lnaltaiskkigcngffpfqirpgknetdgrmfspaigivedpvtgnangpmgawlvhhn
    vlphdgnvlrvkghqgralgrdgmievtvtirdnqpekvtisgtavilfhaewaiel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qy9C (C:)
    kpqvyhvdaftsqpfrgnsagvvfpadnlseaqmqliarelghsetafllhsddsdvrir
    yftptvevpicghatvaahyvrakvlglgnctiwqtslagkhrvtiekhnddyrisleqg
    tpgfepplegetraaiinalhlteddilpglpiqvattghskvmiplkpevdidalspdl
    naltaiskkigcngffpfqirpgknetdgrmfspaigivedpvtgnangpmgawlvhhnv
    lphdgnvlrvkghqgralgrdgmievtvtirdnqpekvtisgtavilfhaewaiel
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qy9D (D:)
    mkpqvyhvdaftsqpfrgnsagvvfpadnlseaqmqliarelghsetafllhsddsdvri
    ryftptvevpicghatvaahyvrakvlglgnctiwqtslagkhrvtiekhnddyrisleq
    gtpgfepplegetraaiinalhlteddilpglpiqvattghskvmiplkpevdidalspd
    lnaltaiskkigcngffpfqirpgknetdgrmfspaigivedpvtgnangpmgawlvhhn
    vlphdgnvlrvkghqgralgrdgmievtvtirdnqpekvtisgtavilfhaewaiel