PDB entry 1qy7

View 1qy7 on RCSB PDB site
Description: the structure of the pii protein from the cyanobacteria synechococcus sp. pcc 7942
Deposited on 2003-09-09, released 2003-09-23
The last revision prior to the SCOP 1.71 freeze date was dated 2003-12-09, with a file datestamp of 2003-12-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.199
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1qy7a_
  • Chain 'B':
    Domains in SCOP 1.71: d1qy7b_
  • Chain 'C':
    Domains in SCOP 1.71: d1qy7c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qy7A (A:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgaeytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadai
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qy7B (B:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgaeytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadai
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qy7C (C:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgaeytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadai