PDB entry 1qy5

View 1qy5 on RCSB PDB site
Description: Crystal Structure of the N-domain of the ER Hsp90 chaperone GRP94 in complex with the specific ligand NECA
Class: chaperone
Keywords: GRP94, NECA, Hsp90, CHAPERONE
Deposited on 2003-09-09, released 2003-11-11
Made obsolete by 6d28 on 2018-05-16

The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.206
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoplasmin
    Species: Canis lupus familiaris [TaxId:9615]
    Gene: TRA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1qy5a_
  • Heterogens: NEC, M2M, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qy5A (A:)
    lreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalag
    neeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqedgqst
    seligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttit
    lvlkeeasdyleldtiknlvkkysqfinfpiyvwssktetveepmeeeeaakeekedsdd
    eaaveeeeeekkpktkkvektvwdwelmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qy5A (A:)
    ksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagnee
    ltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqedgqstsel
    igqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvl
    keeasdyleldtiknlvkkysqfinfpiyvwssktktvwdwelmn