PDB entry 1qy4

View 1qy4 on RCSB PDB site
Description: Crystal structure of phosphoglucose isomerase from Pyrococcus furiosus in complex with gluconate 6-phosphate
Deposited on 2003-09-09, released 2003-12-09
The last revision prior to the SCOP 1.71 freeze date was dated 2003-12-09, with a file datestamp of 2003-12-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.22
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1qy4a_
  • Chain 'B':
    Domains in SCOP 1.71: d1qy4b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qy4A (A:)
    mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe
    ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi
    smepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk
    vvdnprwkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qy4A (A:)
    mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe
    ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi
    smepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk
    vvdnprw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qy4B (B:)
    mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe
    ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi
    smepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk
    vvdnprwkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qy4B (B:)
    mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe
    ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi
    smepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk
    vvdnprw