PDB entry 1qxy

View 1qxy on RCSB PDB site
Description: Crystal structure of S. aureus methionine aminopeptidase in complex with a ketoheterocycle 618
Class: hydrolase
Keywords: pita bread fold, hydrolase
Deposited on 2003-09-09, released 2004-03-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.04 Å
R-factor: 0.144
AEROSPACI score: 0.97 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methionyl aminopeptidase
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qxya_
  • Heterogens: CO, ACT, M2C, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qxyA (A:)
    mivkteeelqalkeigyicakvrntmqaatkpgittkeldniakelfeeygaisapihde
    nfpgqtcisvneevahgipskrviregdlvnidvsalkngyyadtgisfvvgesddpmkq
    kvcdvatmafenaiakvkpgtklsnigkavhntarqndlkviknltghgvglslheapah
    vlnyfdpkdktlltegmvlaiepfissnasfvtegknewafetsdksfvaqiehtvivtk
    dgpilttkieee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qxyA (A:)
    mivkteeelqalkeigyicakvrntmqaatkpgittkeldniakelfeeygaisapihde
    nfpgqtcisvneevahgipskrviregdlvnidvsalkngyyadtgisfvvgesddpmkq
    kvcdvatmafenaiakvkpgtklsnigkavhntarqndlkviknltghgvglslheapah
    vlnyfdpkdktlltegmvlaiepfissnasfvtegknewafetsdksfvaqiehtvivtk
    dgpilttki