PDB entry 1qxx

View 1qxx on RCSB PDB site
Description: crystal structure of the c-terminal domain of tonb
Class: transport protein
Keywords: TonB Dimerization,, TRANSPORT PROTEIN
Deposited on 2003-09-09, released 2004-04-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.267
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TonB protein
    Species: Escherichia coli [TaxId:562]
    Gene: tonB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1qxxa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qxxA (A:)
paraqalriegqvkvkfdvtpdgrvdnvqilsakpanmferevknamrrwryepgkpgsg
ivvnilfkingtteiq