PDB entry 1qxs

View 1qxs on RCSB PDB site
Description: CRYSTAL STRUCTURE OF Trypanosoma cruzi GLYCERALDEHYDE-3- PHOSPHATE DEHYDROGENASE COMPLEXED WITH AN ANALOGUE OF 1,3- BisPHOSPHO-D-GLYCERIC ACID
Class: oxidoreductase
Keywords: gGAPDH 1,3-BPGA analogue complex
Deposited on 2003-09-08, released 2004-05-11
The last revision prior to the SCOP 1.75 freeze date was dated 2004-05-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.198
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glyceraldehyde 3-phosphate dehydrogenase, glycosomal
    Species: TRYPANOSOMA CRUZI
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1qxsa1, d1qxsa2
  • Chain 'B':
    Compound: Glyceraldehyde 3-phosphate dehydrogenase, glycosomal
    Species: TRYPANOSOMA CRUZI
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1qxsb1, d1qxsb2
  • Chain 'C':
    Compound: Glyceraldehyde 3-phosphate dehydrogenase, glycosomal
    Species: TRYPANOSOMA CRUZI
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1qxsc1, d1qxsc2
  • Chain 'D':
    Compound: Glyceraldehyde 3-phosphate dehydrogenase, glycosomal
    Species: TRYPANOSOMA CRUZI
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1qxsd1, d1qxsd2
  • Heterogens: NAD, S70, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qxsA (A:)
    mpikvgingfgrigrmvfqalcedgllgteidvvavvdmntdaeyfayqmrydtvhgkfk
    yevtttksspsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftakaaa
    eghlrggarkvvisapasggaktlvmgvnhheynpsehhvvsnascttnclapivhvlvk
    egfgvqtglmttihsytatqktvdgvsvkdwrggraaavniipsttgaakavgmvipstq
    gkltgmsfrvptpdvsvvdltftaardtsiqeidaalkrasktymkgilgytdeelvsad
    findnrssiydskatlqnnlpkerrffkivswydnewgyshrvvdlvrhmaskdrsarl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qxsB (B:)
    mpikvgingfgrigrmvfqalcedgllgteidvvavvdmntdaeyfayqmrydtvhgkfk
    yevtttksspsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftakaaa
    eghlrggarkvvisapasggaktlvmgvnhheynpsehhvvsnascttnclapivhvlvk
    egfgvqtglmttihsytatqktvdgvsvkdwrggraaavniipsttgaakavgmvipstq
    gkltgmsfrvptpdvsvvdltftaardtsiqeidaalkrasktymkgilgytdeelvsad
    findnrssiydskatlqnnlpkerrffkivswydnewgyshrvvdlvrhmaskdrsarl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qxsC (C:)
    mpikvgingfgrigrmvfqalcedgllgteidvvavvdmntdaeyfayqmrydtvhgkfk
    yevtttksspsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftakaaa
    eghlrggarkvvisapasggaktlvmgvnhheynpsehhvvsnascttnclapivhvlvk
    egfgvqtglmttihsytatqktvdgvsvkdwrggraaavniipsttgaakavgmvipstq
    gkltgmsfrvptpdvsvvdltftaardtsiqeidaalkrasktymkgilgytdeelvsad
    findnrssiydskatlqnnlpkerrffkivswydnewgyshrvvdlvrhmaskdrsarl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qxsD (D:)
    mpikvgingfgrigrmvfqalcedgllgteidvvavvdmntdaeyfayqmrydtvhgkfk
    yevtttksspsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftakaaa
    eghlrggarkvvisapasggaktlvmgvnhheynpsehhvvsnascttnclapivhvlvk
    egfgvqtglmttihsytatqktvdgvsvkdwrggraaavniipsttgaakavgmvipstq
    gkltgmsfrvptpdvsvvdltftaardtsiqeidaalkrasktymkgilgytdeelvsad
    findnrssiydskatlqnnlpkerrffkivswydnewgyshrvvdlvrhmaskdrsarl