PDB entry 1qxn

View 1qxn on RCSB PDB site
Description: Solution Structure of the 30 kDa Polysulfide-sulfur Transferase Homodimer from Wolinella Succinogenes
Class: transferase
Keywords: polysulfide-sulfur transferase, sud, homodimer
Deposited on 2003-09-08, released 2004-02-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sulfide dehydrogenase
    Species: Wolinella succinogenes [TaxId:844]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56748 (0-128)
      • expression tag (129-136)
    Domains in SCOPe 2.05: d1qxna_
  • Chain 'B':
    Compound: sulfide dehydrogenase
    Species: Wolinella succinogenes [TaxId:844]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56748 (0-128)
      • expression tag (129-136)
    Domains in SCOPe 2.05: d1qxnb_
  • Heterogens: PS5

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qxnA (A:)
admgekfdatfkaqvkaakadmvmlspkdaykllqenpditlidvrdpdelkamgkpdvk
nykhmsrgklepllaksgldpekpvvvfcktaaraalagktlreygfktiynseggmdkw
leeglpsldrshhhhhh

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qxnB (B:)
admgekfdatfkaqvkaakadmvmlspkdaykllqenpditlidvrdpdelkamgkpdvk
nykhmsrgklepllaksgldpekpvvvfcktaaraalagktlreygfktiynseggmdkw
leeglpsldrshhhhhh