PDB entry 1qxn

View 1qxn on RCSB PDB site
Description: solution structure of the 30 kda polysulfide-sulfur transferase homodimer from wolinella succinogenes
Deposited on 2003-09-08, released 2004-02-24
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-24, with a file datestamp of 2004-02-24.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1qxna_
  • Chain 'B':
    Domains in SCOP 1.67: d1qxnb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qxnA (A:)
    admgekfdatfkaqvkaakadmvmlspkdaykllqenpditlidvrdpdelkamgkpdvk
    nykhmsrgklepllaksgldpekpvvvfcktaaraalagktlreygfktiynseggmdkw
    leeglpsldrshhhhhh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qxnB (B:)
    admgekfdatfkaqvkaakadmvmlspkdaykllqenpditlidvrdpdelkamgkpdvk
    nykhmsrgklepllaksgldpekpvvvfcktaaraalagktlreygfktiynseggmdkw
    leeglpsldrshhhhhh