PDB entry 1qxm

View 1qxm on RCSB PDB site
Description: Crystal structure of a hemagglutinin component (HA1) from type C Clostridium botulinum
Class: toxin
Keywords: Clostridium botulinum, hemagglutinin, HA1, trefoil, TOXIN
Deposited on 2003-09-08, released 2004-01-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.7000000000000002 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ha1
    Species: Clostridium phage c-st [TaxId:29342]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qxma1, d1qxma2
  • Chain 'B':
    Compound: ha1
    Species: Clostridium phage c-st [TaxId:29342]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qxmb1, d1qxmb2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qxmA (A:)
    gshhhhhhhhhhrsmsqtnandlrnnevffispsnntnkvldkisqsevklwnklsganq
    kwrliydtnkqaykikvmdntsliltwnaplssvsvktdtngdnqywyllqnyisrnvii
    rnymnpnlvlqyniddtlmvstqtsssnqffkfsnciyealnnrncklqtqlnsdrflsk
    nlnsqiivlwqwfdssrqkwiieynetksaytlkcqennryltwiqnsnnyvetyqstds
    liqywninyldndaskyilynlqdtnrvldvynsqiangthvivdsyhgntnqqwiinli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qxmA (A:)
    tnandlrnnevffispsnntnkvldkisqsevklwnklsganqkwrliydtnkqaykikv
    mdntsliltwnaplssvsvktdtngdnqywyllqnyisrnviirnymnpnlvlqyniddt
    lmvstqtsssnqffkfsnciyealnnrncklqtqlnsdrflsknlnsqiivlwqwfdssr
    qkwiieynetksaytlkcqennryltwiqnsnnyvetyqstdsliqywninyldndasky
    ilynlqdtnrvldvynsqiangthvivdsyhgntnqqwiinli
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qxmB (B:)
    gshhhhhhhhhhrsmsqtnandlrnnevffispsnntnkvldkisqsevklwnklsganq
    kwrliydtnkqaykikvmdntsliltwnaplssvsvktdtngdnqywyllqnyisrnvii
    rnymnpnlvlqyniddtlmvstqtsssnqffkfsnciyealnnrncklqtqlnsdrflsk
    nlnsqiivlwqwfdssrqkwiieynetksaytlkcqennryltwiqnsnnyvetyqstds
    liqywninyldndaskyilynlqdtnrvldvynsqiangthvivdsyhgntnqqwiinli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qxmB (B:)
    tnandlrnnevffispsnntnkvldkisqsevklwnklsganqkwrliydtnkqaykikv
    mdntsliltwnaplssvsvktdtngdnqywyllqnyisrnviirnymnpnlvlqyniddt
    lmvstqtsssnqffkfsnciyealnnrncklqtqlnsdrflsknlnsqiivlwqwfdssr
    qkwiieynetksaytlkcqennryltwiqnsnnyvetyqstdsliqywninyldndasky
    ilynlqdtnrvldvynsqiangthvivdsyhgntnqqwiinli