PDB entry 1qxj

View 1qxj on RCSB PDB site
Description: Crystal structure of native phosphoglucose isomerase from Pyrococcus furiosus
Deposited on 2003-09-07, released 2003-12-09
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-09, with a file datestamp of 2003-12-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.197
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1qxja_
  • Chain 'B':
    Domains in SCOP 1.67: d1qxjb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qxjA (A:)
    mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe
    ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi
    smepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk
    vvdnprwkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qxjA (A:)
    mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe
    ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi
    smepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk
    vvdnprw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qxjB (B:)
    mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe
    ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi
    smepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk
    vvdnprwkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qxjB (B:)
    mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe
    ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi
    smepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk
    vvdnprw