PDB entry 1qxj

View 1qxj on RCSB PDB site
Description: Crystal structure of native phosphoglucose isomerase from Pyrococcus furiosus
Class: isomerase
Keywords: phosphoglucose isomerase, cupin fold, Pyrococcus furiosus, hyperthermophile, extremophile, aldose-ketose isomerase
Deposited on 2003-09-07, released 2003-12-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.197
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucose-6-phosphate isomerase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PGIA OR PF0196
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qxja_
  • Chain 'B':
    Compound: Glucose-6-phosphate isomerase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PGIA OR PF0196
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qxjb_
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qxjA (A:)
    mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe
    ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi
    smepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk
    vvdnprwkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qxjA (A:)
    mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe
    ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi
    smepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk
    vvdnprw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qxjB (B:)
    mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe
    ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi
    smepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk
    vvdnprwkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qxjB (B:)
    mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe
    ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi
    smepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk
    vvdnprw