PDB entry 1qxa

View 1qxa on RCSB PDB site
Description: Crystal structure of Sortase B complexed with Gly3
Class: hydrolase
Keywords: Sortase, transpeptidase, cysteine protease, HYDROLASE
Deposited on 2003-09-05, released 2004-04-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.221
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NPQTN specific sortase B
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qxaa_
  • Chain 'B':
    Compound: peptide GLY-GLY-GLY
    Database cross-references and differences (RAF-indexed):
    • PDB 1QXA (0-2)
  • Heterogens: ETM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qxaA (A:)
    ghhhhhhhhhhssghisgdamedkqeranyeklqqkfqmlmskhqahvrpqfeslekink
    divgwiklsgtslnypvlqgktnhdylnldferehrrkgsifmdfrnelknlnhntilyg
    hhvgdntmfdvledylkqsfyekhkiiefdnkygkyqlqvfsayktttkdnyirtdfend
    qdyqqfldetkrksvinsdvnvtvkdrimtlstcedaysettkrivvvakiikvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qxaA (A:)
    edkqeranyeklqqkfqmlmskhqahvrpqfeslekinkdivgwiklsgtslnypvlqgk
    tnhdylnldferehrrkgsifmdfrnelknlnhntilyghhvgdntmfdvledylkqsfy
    ekhkiiefdnkygkyqlqvfsayktttkdnyirtdfendqdyqqfldetkrksvinsdvn
    vtvkdrimtlstcedaysettkrivvvakiikvs
    

  • Chain 'B':
    No sequence available.