PDB entry 1qx8

View 1qx8 on RCSB PDB site
Description: Crystal structure of a five-residue deletion mutant of the Rop protein
Class: transcription
Keywords: replication; initiation of transcription; RNA primer; x-ray, transcription
Deposited on 2003-09-04, released 2004-09-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.191
AEROSPACI score: -1.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulatory protein rop
    Species: Escherichia coli [TaxId:562]
    Gene: ROP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qx8a_
  • Chain 'B':
    Compound: Regulatory protein rop
    Species: Escherichia coli [TaxId:562]
    Gene: ROP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qx8b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qx8A (A:)
    mtkqektalnmarfirsqtltlleklneladiceslhdhadelyrsclarfgddgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qx8A (A:)
    ektalnmarfirsqtltlleklneladiceslhdhadelyrsclarf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qx8B (B:)
    mtkqektalnmarfirsqtltlleklneladiceslhdhadelyrsclarfgddgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qx8B (B:)
    mtkqektalnmarfirsqtltlleklneladiceslhdhadelyrsclarf