PDB entry 1qx6

View 1qx6 on RCSB PDB site
Description: Crystal structure of Sortase B complexed with E-64
Class: hydrolase
Keywords: Sortase, Transpeptidase, cysteine protease, E-64, HYDROLASE
Deposited on 2003-09-04, released 2004-04-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.235
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NPQTN specific sortase B
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NX63 (0-213)
      • modified residue (17)
      • modified residue (19)
      • modified residue (81)
      • modified residue (106)
      • modified residue (187)
    Domains in SCOPe 2.01: d1qx6a_
  • Heterogens: E64, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qx6A (A:)
    edkqeranyeklqqkfqmlmskhqahvrpqfeslekinkdivgwiklsgtslnypvlqgk
    tnhdylnldferehrrkgsifmdfrnelknlnhntilyghhvgdntmfdvledylkqsfy
    ekhkiiefdnkygkyqlqvfsayktttkdnyirtdfendqdyqqfldetkrksvinsdvn
    vtvkdrimtlstcedaysettkrivvvakiikvs