PDB entry 1qx2

View 1qx2 on RCSB PDB site
Description: X-ray Structure of Calcium-loaded Calbindomodulin (A Calbindin D9k Re-engineered to Undergo a Conformational Opening) at 1.44 A Resolution
Class: Signaling Protein
Keywords: EF-Hand (helix-loop-helix) Calcium Binding Protein, Four-helix Domain, Protein Engineering, Calcium-induced Conformational Response, calmodulin, calbindin D9k, Signaling Protein
Deposited on 2003-09-04, released 2004-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: 0.158
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vitamin d-dependent calcium-binding protein, intestinal
    Species: Bos taurus [TaxId:9913]
    Gene: CALB3 OR S100D
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02633 (1-75)
      • initiating residue (0)
      • engineered (6)
      • engineered (9)
      • engineered (12-13)
      • engineered (23)
      • engineered (31-32)
      • engineered (35-36)
      • engineered (43)
      • engineered (49-50)
      • engineered (53)
      • engineered (67)
      • engineered (69-70)
    Domains in SCOPe 2.08: d1qx2a_
  • Chain 'B':
    Compound: vitamin d-dependent calcium-binding protein, intestinal
    Species: Bos taurus [TaxId:9913]
    Gene: CALB3 OR S100D
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02633 (1-End)
      • initiating residue (0)
      • engineered (6)
      • engineered (9)
      • engineered (12-13)
      • engineered (23)
      • engineered (31-32)
      • engineered (35-36)
      • engineered (43)
      • engineered (49-50)
      • engineered (53)
      • engineered (67)
      • engineered (69-70)
    Domains in SCOPe 2.08: d1qx2b_
  • Heterogens: CA, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qx2A (A:)
    mkspeeikgafevfaakegdpnqiskeelklvmqtlgpsllkgmstldemieevdkngdg
    evsfeeflvmmkkisq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qx2B (B:)
    mkspeeikgafevfaakegdpnqiskeelklvmqtlgpsllkgmstldemieevdkngdg
    evsfeeflvmmkkisq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qx2B (B:)
    mkspeeikgafevfaakegdpnqiskeelklvmqtlgpsllkgmstldemieevdkngdg
    evsfeeflvmmkkis