PDB entry 1qx0

View 1qx0 on RCSB PDB site
Description: conjugative relaxase trwc in complex with orit DNA. metal-bound structure
Class: transferase/DNA
Keywords: protein-DNA complex, bacterial conjugation, relaxase, DNA replication, transferase/DNA complex
Deposited on 2003-09-04, released 2003-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: 0.239
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trwC protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47673 (0-292)
      • modified residue (0)
      • modified residue (4)
      • modified residue (69)
      • modified residue (168)
    Domains in SCOPe 2.07: d1qx0a_
  • Chain 'B':
    Compound: DNA oligonucleotide
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qx0A (A:)
    mlshmvltrqdigraasyyedgaddyyakdgdasewqgkgaeelglsgevdskrfrella
    gnigeghrimrsatrqdskerigldltfsapksvslqalvagdaeiikahdravartleq
    aearaqarqkiqgktriettgnlvigkfrhetsrerdpqlhthavilnmtkrsdgqwral
    kndeivkatrylgavynaelahelqklgyqlrygkdgnfdlahidrqqiegfskrteqia
    ewyaargldpnsvsleqkqaakvlsrakktsvdrealraewqatakelgidfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qx0A (A:)
    mlshmvltrqdigraasyyedgaddyydasewqgkgaeelglsgevdskrfrellagnig
    eghrimrsatrqdskerigldltfsapksvslqalvagdaeiikahdravartleqaear
    aqarqkiqgktriettgnlvigkfrhetsrerdpqlhthavilnmtkrsdgqwralknde
    ivkatrylgavynaelahelqklgyqlrygkdgnfdlahidrqqiegfskrteqiaewya
    argldpnsvsleqkqaakvlsrakktsvdrealraewqatakelgidfs
    

  • Chain 'B':
    No sequence available.