PDB entry 1qwz

View 1qwz on RCSB PDB site
Description: Crystal structure of Sortase B from S. aureus complexed with MTSET
Deposited on 2003-09-03, released 2004-04-06
The last revision prior to the SCOP 1.69 freeze date was dated 2004-04-06, with a file datestamp of 2004-04-06.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.183
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1qwza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qwzA (A:)
    ghhhhhhhhhhssghisgdamedkqeranyeklqqkfqmlmskhqahvrpqfeslekink
    divgwiklsgtslnypvlqgktnhdylnldferehrrkgsifmdfrnelknlnhntilyg
    hhvgdntmfdvledylkqsfyekhkiiefdnkygkyqlqvfsayktttkdnyirtdfend
    qdyqqfldetkrksvinsdvnvtvkdrimtlstcedaysettkrivvvakiikvs