PDB entry 1qwz

View 1qwz on RCSB PDB site
Description: Crystal structure of Sortase B from S. aureus complexed with MTSET
Class: hydrolase
Keywords: Beta barrel, transpeptidase, HYDROLASE
Deposited on 2003-09-03, released 2004-04-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.183
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NPQTN specific sortase B
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NX63 (21-234)
      • expression tag (0-20)
    Domains in SCOPe 2.08: d1qwza1, d1qwza2
  • Heterogens: NI, SO4, ETM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qwzA (A:)
    ghhhhhhhhhhssghisgdamedkqeranyeklqqkfqmlmskhqahvrpqfeslekink
    divgwiklsgtslnypvlqgktnhdylnldferehrrkgsifmdfrnelknlnhntilyg
    hhvgdntmfdvledylkqsfyekhkiiefdnkygkyqlqvfsayktttkdnyirtdfend
    qdyqqfldetkrksvinsdvnvtvkdrimtlstcedaysettkrivvvakiikvs