PDB entry 1qwx

View 1qwx on RCSB PDB site
Description: Crystal Structure of a Staphylococcal Inhibitor/Chaperone
Deposited on 2003-09-03, released 2004-02-10
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-10, with a file datestamp of 2004-02-10.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.201
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1qwxa_
  • Chain 'B':
    Domains in SCOP 1.67: d1qwxb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qwxA (A:)
    myqlqfinlvydttklthleqtninlfmgnwsnhqlqksicirhgddtshnqyhilfidt
    ahqrikfssidneeiiyildyddtqhilmqtsskqgigtsrpivyerlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qwxA (A:)
    myqlqfinlvydttklthleqtninlfmgnwsnhqlqksicirhgddtshnqyhilfidt
    ahqrikfssidneeiiyildyddtqhilmqtsskqgigtsrpivyerl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qwxB (B:)
    myqlqfinlvydttklthleqtninlfmgnwsnhqlqksicirhgddtshnqyhilfidt
    ahqrikfssidneeiiyildyddtqhilmqtsskqgigtsrpivyerlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qwxB (B:)
    myqlqfinlvydttklthleqtninlfmgnwsnhqlqksicirhgddtshnqyhilfidt
    ahqrikfssidneeiiyildyddtqhilmqtsskqgigtsrpivyerl