PDB entry 1qwv

View 1qwv on RCSB PDB site
Description: solution structure of antheraea polyphemus pheromone binding protein (apolpbp)
Deposited on 2003-09-03, released 2004-03-23
The last revision prior to the SCOP 1.71 freeze date was dated 2004-03-23, with a file datestamp of 2004-03-23.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1qwva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qwvA (A:)
speimknlsnnfgkamdqckdelslpdsvvadlynfwkddyvmtdrlagcainclatkld
vvdpdgnlhhgnakdfamkhgadetmaqqlvdiihgceksappnddkcmktidvamcfkk
eihklnwvpnmdlvigevlaev